PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05108.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 246aa    MW: 27066.4 Da    PI: 8.3786
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05108.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc05108.1.g00070.1.am.mk 14 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 61
                                  79********************************************97 PP

2Myb_DNA-binding57.33.7e-1867111147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T eEd+ +++++++lG++ W++Ia +++ gRt++++k++w+++
  Zmw_sc05108.1.g00070.1.am.mk  67 RGNFTDEEDDTIIKLHQMLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                                   89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.526961IPR017930Myb domain
SuperFamilySSF466893.06E-3013108IPR009057Homeodomain-like
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-151461IPR001005SANT/Myb domain
CDDcd001672.11E-111661No hitNo description
PROSITE profilePS5129427.66262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2865116IPR009057Homeodomain-like
SMARTSM007177.5E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667111IPR001005SANT/Myb domain
CDDcd001671.11E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRSL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDDTIIK LHQMLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
IDPKTHRPLN ETSTSAAPPR THRQDHTARP SCSPQTSLSA GSMPAETSRR ELDSCVDLNL  180
SIAPPQYQPA PLQGHEEEGQ AAGCSTMSSS TKGTAGTTNS EKERICLCFN GLGSQCDEGC  240
TCGSDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-30141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977235.11e-107PREDICTED: myb-related protein Zm38-like
SwissprotP813931e-91MYB08_ANTMA; Myb-related protein 308
TrEMBLK3YEC21e-107K3YEC2_SETIT; Uncharacterized protein
STRINGSi012585m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448